PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G47640.1
Common NameHAP3B, MNJ7.23, NFYB2, NF-YB2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YB
Protein Properties Length: 190aa    MW: 20529.5 Da    PI: 6.5143
Description nuclear factor Y, subunit B2
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G47640.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.73.6e-5826121297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege+
  AT5G47640.1  26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 121
                  89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.7E-5420128IPR009072Histone-fold
SuperFamilySSF471131.55E-4128138IPR009072Histone-fold
PfamPF008081.2E-283195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.3E-215977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.3E-217896No hitNo description
PRINTSPR006157.3E-2197115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MGDSDRDSGG GQNGNNQNGQ SSLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ  60
ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKVY LQRFREIEGE  120
RTGLGRPQTG GEVGEHQRDA VGDGGGFYGG GGGMQYHQHH QFLHQQNHMY GATGGGSDSG  180
GGAASGRTRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-4926116292Transcription factor HapC (Eurofung)
4g92_B7e-4926116292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.214940.0seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453589660.0
Genevisible248764_at0.0
Expression AtlasAT5G47640-
AtGenExpressAT5G47640-
ATTED-IIAT5G47640-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Function -- GeneRIF ? help Back to Top
  1. can promote flowering by enhancing expression of key flowering time genes such as FLOWERING LOCUS T and SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1
    [PMID: 17631525]
  2. Our results provide evidence to support a role of HAP3b in regulation of root growth.
    [PMID: 21316979]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G47640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G14920, AT1G28050, AT1G54830, AT1G56170
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G47640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256280.0AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
GenBankAF3857440.0AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBankAY0780260.0AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199575.11e-140nuclear transcription factor Y subunit B-2
SwissprotQ9FGJ31e-142NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBLA0A078HTQ13e-97A0A078HTQ1_BRANA; BnaA09g18400D protein
TrEMBLM4DLU23e-97M4DLU2_BRARP; Uncharacterized protein
TrEMBLW6DGI73e-97W6DGI7_BRANA; BnaC09g20320D protein
STRINGAT5G47640.11e-139(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Representative plantOGRP16817170
Publications ? help Back to Top
  1. Kleinow T, et al.
    Functional identification of an Arabidopsis snf4 ortholog by screening for heterologous multicopy suppressors of snf4 deficiency in yeast.
    Plant J., 2000. 23(1): p. 115-22
    [PMID:10929106]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  4. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  5. Kreps JA, et al.
    Transcriptome changes for Arabidopsis in response to salt, osmotic, and cold stress.
    Plant Physiol., 2002. 130(4): p. 2129-41
    [PMID:12481097]
  6. Kwong RW, et al.
    LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
    Plant Cell, 2003. 15(1): p. 5-18
    [PMID:12509518]
  7. Hudson ME,Lisch DR,Quail PH
    The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.
    Plant J., 2003. 34(4): p. 453-71
    [PMID:12753585]
  8. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  9. Stevens R, et al.
    A CDC45 homolog in Arabidopsis is essential for meiosis, as shown by RNA interference-induced gene silencing.
    Plant Cell, 2004. 16(1): p. 99-113
    [PMID:14660803]
  10. Sharma N,Cram D,Huebert T,Zhou N,Parkin IA
    Exploiting the wild crucifer Thlaspi arvense to identify conserved and novel genes expressed during a plant's response to cold stress.
    Plant Mol. Biol., 2007. 63(2): p. 171-84
    [PMID:16972165]
  11. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  12. Xin Z,Mandaokar A,Chen J,Last RL,Browse J
    Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.
    Plant J., 2007. 49(5): p. 786-99
    [PMID:17316173]
  13. Cai X, et al.
    A putative CCAAT-binding transcription factor is a regulator of flowering timing in Arabidopsis.
    Plant Physiol., 2007. 145(1): p. 98-105
    [PMID:17631525]
  14. Peng M,Bi YM,Zhu T,Rothstein SJ
    Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA.
    Plant Mol. Biol., 2007. 65(6): p. 775-97
    [PMID:17885809]
  15. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  16. Richardt S, et al.
    Microarray analysis of the moss Physcomitrella patens reveals evolutionarily conserved transcriptional regulation of salt stress and abscisic acid signalling.
    Plant Mol. Biol., 2010. 72(1-2): p. 27-45
    [PMID:19806323]
  17. Kumimoto RW,Zhang Y,Siefers N,Holt BF
    NF-YC3, NF-YC4 and NF-YC9 are required for CONSTANS-mediated, photoperiod-dependent flowering in Arabidopsis thaliana.
    Plant J., 2010. 63(3): p. 379-91
    [PMID:20487380]
  18. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  19. Ballif J,Endo S,Kotani M,MacAdam J,Wu Y
    Over-expression of HAP3b enhances primary root elongation in Arabidopsis.
    Plant Physiol. Biochem., 2011. 49(6): p. 579-83
    [PMID:21316979]
  20. Liang M,Hole D,Wu J,Blake T,Wu Y
    Expression and functional analysis of NUCLEAR FACTOR-Y, subunit B genes in barley.
    Planta, 2012. 235(4): p. 779-91
    [PMID:22042327]
  21. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  22. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
    [PMID:22912760]
  23. Hou X, et al.
    Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis.
    Nat Commun, 2014. 5: p. 4601
    [PMID:25105952]
  24. Sato H, et al.
    Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.
    Plant Cell, 2014. 26(12): p. 4954-73
    [PMID:25490919]
  25. Edwards D,Murray JA,Smith AG
    Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis.
    Plant Physiol., 1998. 117(3): p. 1015-22
    [PMID:9662544]